PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS70016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 173aa    MW: 20339.2 Da    PI: 9.3955
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS70016.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.61.2e-261059251
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                rienk++rq +f kRr g+lKKA+ELSvLCda+va+iifs++gkl e+ s
  EPS70016.1 10 RIENKRKRQASFGKRRDGLLKKAHELSVLCDADVALIIFSNEGKLCEFTS 59
                8**********************************************975 PP

2K-box71.82e-2483173898
       K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                 + eea +e  ++++ +Lk+++++L r+qRh+ GedL++ sl eL +Le  ++ sl+++R+kK++++++++ elq+ke++l ++n+aLr+k+
  EPS70016.1  83 EEEEAPTEGRYRDYLNLKSRLQSLLRSQRHFFGEDLKNFSLGELDRLEILMDASLNRVRAKKTQHMIDELAELQQKENKLMKINRALRNKV 173
                 457777888999****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.674161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-33160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-29277IPR002100Transcription factor, MADS-box
CDDcd002654.09E-31275No hitNo description
PRINTSPR004048.1E-27323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.7E-2089173IPR002487Transcription factor, K-box
PROSITE profilePS5129712.17589173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGRGRVELRR IENKRKRQAS FGKRRDGLLK KAHELSVLCD ADVALIIFSN EGKLCEFTSA  60
HSMDHTLQRY YTANYLPAEE EEEEEEAPTE GRYRDYLNLK SRLQSLLRSQ RHFFGEDLKN  120
FSLGELDRLE ILMDASLNRV RAKKTQHMID ELAELQQKEN KLMKINRALR NKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-17274172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-17274172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-17274172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-17274172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011102220.13e-63PREDICTED: MADS-box protein CMB1-like
SwissprotQ396853e-59CMB1_DIACA; MADS-box protein CMB1
TrEMBLS8CYC71e-124S8CYC7_9LAMI; Uncharacterized protein (Fragment)
STRINGGLYMA02G13401.17e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.18e-51MIKC_MADS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]